Tesamorelin

$29.00

Anti-Ageing and HGH

Category:

Description

A growth hormone-releasing hormone (GHRH) analogue. Specifically studied for reducing visceral abdominal fat and improving metabolic health markers.

Amino Acid Sequence: (trans-3-hexenoyl)-YADAIFTNSYRKVLAQLSARKLLQDILNRQQGERNQEQGA-NH₂

Molar Mass: 5135.9 g/mol

Storage: Keep refrigerated after reconstitution.

 

FOR RESEARCH USE ONLY:

This product is strictly intended for laboratory research and development purposes. It is not a drug, food, or cosmetic and is not approved for human consumption, veterinary use, or diagnostic procedures.

The chemical, physical, and toxicological properties of this material have not been fully investigated. It should be handled only by qualified individuals trained in laboratory procedures and familiar with the potential hazards of chemicals. All research must be conducted in compliance with applicable local, state, and federal regulations.

Additional information

Quantity

5mg, 10mg, 15mg

Reviews

There are no reviews yet.

Be the first to review “Tesamorelin”

Your email address will not be published. Required fields are marked *

Related products

Entrance Agreement

Age Requirement: All customers must be at least 21 years of age.
Product Use: All products are sold for in-vitro research applications only. They are not for human or animal consumption, cosmetic use, or as dietary supplements.
No Medical Advice: We are not a pharmacy or medical provider. We do not provide medical advice, dosing instructions, or reconstitution guidance for human use.
Compliance: It is the researcher’s responsibility to handle all materials in accordance with their institution’s safety protocols and all applicable local, state, and federal laws.
Sales Are Final: Due to the nature of these materials, all sales are final. We do not accept returns or exchanges.

All products offered by BeanTides© are supplied strictly for laboratory research and development use. They are not formulated, marketed, or approved for human consumption or use in animals. No statements on this website have been reviewed by the U.S. Food and Drug Administration, and neither our content nor our products are intended to diagnose, treat, cure, or prevent any disease. BeanTides© operates as a chemical supplier. BeanTides© is not a compounding pharmacy or chemical compounding facility as described in Section 503A of the Federal Food, Drug, and Cosmetic Act, and BeanTides© is not an outsourcing facility as described in Section 503B of the same Act.

By clicking “I AGREE,” you confirm you have read and agree the above.